PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G166800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 356aa    MW: 39287.1 Da    PI: 5.4281
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G166800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.3e-56211481129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdee++++yL++k+ +++++   vi evd++k+ePw+Lp ++k +ekewyfF+++d+ky+tg+r+nrat+sgyWkatgkdke
  Brast02G166800.1.p  21 LPPGFRFHPTDEEIISHYLTPKALDDRFSS-GVIGEVDLNKCEPWHLPGQAKMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKE 110
                         79*************************999.99***************999999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++ +g lvg+kktLvfy+grap+g+kt Wvmhe+rle
  Brast02G166800.1.p 111 IFRGRGVLVGMKKTLVFYRGRAPRGQKTGWVMHEFRLE 148
                         ***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-6316171IPR003441NAC domain
PROSITE profilePS5100557.7321171IPR003441NAC domain
PfamPF023656.9E-2922147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MSEVSVINQA EVEDSAAGLN LPPGFRFHPT DEEIISHYLT PKALDDRFSS GVIGEVDLNK  60
CEPWHLPGQA KMGEKEWYFF CHKDRKYPTG TRTNRATESG YWKATGKDKE IFRGRGVLVG  120
MKKTLVFYRG RAPRGQKTGW VMHEFRLEGK LPHPLPRSAK DEWAVSKVFN KELLTTASNG  180
TTMAAAEAEI ERVNSFGFIS DFLDSAELPP LMDPSFGGDV DEVIDFKGPA STSGYAAGDA  240
GAHSGMDYQL QVKMEEPVPL QYQHQQQHMM YSSPYFSLPA VNSGDMSPAI RRYCKAEQVS  300
GQTSVLSPSR ETGLSTDPNA AGCAEISSAV TPASQQFLDH LDEYPALNLA DIWKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-52131727169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558001.10.0PREDICTED: NAC domain-containing protein 92-like
TrEMBLI1H5X60.0I1H5X6_BRADI; Uncharacterized protein
STRINGBRADI1G63630.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.28e-94Arabidopsis NAC domain containing protein 87